PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa07g054640.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 516aa    MW: 59468.2 Da    PI: 10.1297
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa07g054640.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B341.42.6e-135781796
                    E--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3 17 vlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96
                    ++p  f+ ++ +g  e++kt +l++  s   W+vkl  ++++    lt+GWkeF+ a++L+ gD+v+F+ +  ++  ++v++
  Csa07g054640.1  5 TIPVAFFVKYiKGRDEQKKTAKLRSdASKIIWNVKL--DGQR----LTDGWKEFALAHDLRIGDIVIFRQE--RDLAFHVTL 78
                    69999*9999977778999*****9677799*****..9888....***********************44..455457766 PP

2B373.52.6e-23118206393
                     EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..E CS
              B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelv 93 
                      v + +++l+ ++l +pk f++e+g ++ +s +++l++e+grsW++k++ + + g++++++GW +F++angLk+gD+v+Fk+++r  ++  v
  Csa07g054640.1 118 VVNVAPSSLRYDLLLFPKAFVRENGVVT-GSGEIVLMNEKGRSWTLKMKQKPSCGTIYIRGGWINFCHANGLKSGDTVTFKMIQRrGTR--V 206
                     667889999***************9885.666****************99999999*************************99873333..3 PP

3B372.45.7e-23264355497
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                     + + +++l+ + ++lpkkf++e+g+ ++++ +++l++++grsW++ l+ ++  g++++++GWk+F++angL +g +v+Fkl++ ++++l+++++
  Csa07g054640.1 264 ASIAPSSLRYDTMYLPKKFMRENGIYTKRG-EMILMNQKGRSWTLDLRRKNWCGTFFIKRGWKSFCRANGLSAGSIVTFKLIK-KRGTLTLRLI 355
                     5678899999*************8876665.9***************98888999**************************98.7777777765 PP

4B3598.3e-19419515198
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE...EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy.rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                     f++ ++++++ + + l+lp++f++ ++++k  ++++tl d++g++W+ kl   + ks+r  + +GWk+F +an +k++++++++l++++++ +v+
  Csa07g054640.1 419 FVTLTLTPYNVSASVLRLPRPFTRMNDIDK--KTKMTLLDKQGKKWSTKLHLeDDKSKRLRMVGGWKGFLQANCVKANESIMLELIWEEDTICVL 511
                     667778999999999***********9885..558***************778999999****************************88886666 PP

                     EEE- CS
              B3  95 kvfr 98 
                     k+++
  Csa07g054640.1 512 KFRS 515
                     6665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086311.674182IPR003340B3 DNA binding domain
SMARTSM010194.0E-11282IPR003340B3 DNA binding domain
PfamPF023621.1E-8575IPR003340B3 DNA binding domain
SuperFamilySSF1019361.24E-13584IPR015300DNA-binding pseudobarrel domain
CDDcd100171.48E-9579No hitNo description
Gene3DG3DSA:2.40.330.106.8E-21695IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.4E-20111208IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.69E-20113215IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086316.243116213IPR003340B3 DNA binding domain
CDDcd100171.95E-20116211No hitNo description
SMARTSM010199.1E-26117213IPR003340B3 DNA binding domain
PfamPF023621.9E-21117207IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.4E-23254347IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.92E-21258358IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086315.947261358IPR003340B3 DNA binding domain
CDDcd100179.83E-22261356No hitNo description
SMARTSM010195.3E-27262358IPR003340B3 DNA binding domain
PfamPF023625.2E-22263355IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.9E-20411515IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.79E-19413515IPR015300DNA-binding pseudobarrel domain
CDDcd100175.88E-15418514No hitNo description
SMARTSM010198.2E-21419516IPR003340B3 DNA binding domain
PROSITE profilePS5086314.029419516IPR003340B3 DNA binding domain
PfamPF023629.0E-18419515IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 516 aa     Download sequence    Send to blast
MLVQTIPVAF FVKYIKGRDE QKKTAKLRSD ASKIIWNVKL DGQRLTDGWK EFALAHDLRI  60
GDIVIFRQER DLAFHVTLLG PSCCEIQHGS CLEEESNLEK KKEKKSPNEE NEQDSCFVVN  120
VAPSSLRYDL LLFPKAFVRE NGVVTGSGEI VLMNEKGRSW TLKMKQKPSC GTIYIRGGWI  180
NFCHANGLKS GDTVTFKMIQ RRGTRVLRLL PKEQKEEAND VSLSTEPESD EDSNIRKIQR  240
QRKMKKSPRR DTESSSLDNS CFVASIAPSS LRYDTMYLPK KFMRENGIYT KRGEMILMNQ  300
KGRSWTLDLR RKNWCGTFFI KRGWKSFCRA NGLSAGSIVT FKLIKKRGTL TLRLIPNEGE  360
EEEEESSEAN KGESLSRDQE SDEESSHDEK NSQECSRRNE KKRRLLRWTA SSSPSKNRFV  420
TLTLTPYNVS ASVLRLPRPF TRMNDIDKKT KMTLLDKQGK KWSTKLHLED DKSKRLRMVG  480
GWKGFLQANC VKANESIMLE LIWEEDTICV LKFRSK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010417222.10.0PREDICTED: B3 domain-containing protein REM14-like isoform X2
SwissprotO230760.0REM15_ARATH; Putative B3 domain-containing protein REM15
TrEMBLR0FW440.0R0FW44_9BRAS; Uncharacterized protein (Fragment)
STRINGAT4G00260.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.10.0B3 family protein